SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6KN10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6KN10
Domain Number 1 Region: 172-211
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000157
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6KN10
Sequence length 423
Comment (tr|A0A0D6KN10|A0A0D6KN10_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:EKF00844.1} KW=Complete proteome; Reference proteome OX=1188 OS=Tolypothrix sp. PCC 7601. GN=FDUTEX481_08535 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Tolypothrix.
Sequence
MWEYVQYLNAELLDLKLWGEGCSLYQIRQMGDDEICLIQTDDTPQESLCDRWQVVYTERG
AVQQLLFEFTDEAEACEFMYREIKRIKHPHLVGLFPTDAEAEQLCQVLTQLEIQFSHDPK
RRVTVYDQDIFTVERHFGCQLPLRKWLTVPERIHVTLARLRKFDPYNRYAQITTNPPIAS
EAKLSALEAQHGIRLPDIYRTFLLEVCNGGNWERLGNYWSAEEVMANNSAQVWNQPLPEF
LAKLKAAKSGDWLKNPESRQYPGLLRIVDWDNPVRDLFLTQEGYEVEIQGDWIRFCEFSP
EQWLKDFLDDIQYGLSTIEGLLAFLRSGELIRDYPYFHSVNVARLLAETIGINIDPELTN
EQVKMSDEIDYKINQWRIENMGKMRYNFGFNAEQAELRCSVGAATRTQRILERLEYIYNI
LYP
Download sequence
Identical sequences A0A0D6KN10 A0A1Z4M8P1
WP_045871505.1.57613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]