SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6LMK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6LMK5
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000000942
Family Preprotein translocase SecE subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6LMK5
Sequence length 68
Comment (tr|A0A0D6LMK5|A0A0D6LMK5_9BILA) Protein translocase SEC61 complex gamma subunit, and eukaryotic {ECO:0000313|EMBL:EPB72428.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_08461 OC=Ancylostoma.
Sequence
MDQFQALIEPGRQFARDSIRLVKRCTKPDRKEYQKIAVATAIGFAIMGFIGFFVKLIHIP
INNIIVGA
Download sequence
Identical sequences A0A0D6LMK5 W2SIG0
XP_013291570.1.49812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]