SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6M033 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6M033
Domain Number 1 Region: 125-237
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.42e-26
Family Regulator of G-protein signaling, RGS 0.00088
Further Details:      
 
Domain Number 2 Region: 15-126
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000574
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6M033
Sequence length 241
Comment (tr|A0A0D6M033|A0A0D6M033_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:EPB77434.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_03502 OC=Ancylostoma.
Sequence
MSMFDANAKVDRQPPPMPDTNGVEYPRAASWASGTCAAVLKDDKGCQLFRCFLYEALAEE
NLSFVEAVDKLKKMKNSDEKKEYAKEIVQLYSPYINLSSGAMKSMKDAVESENVDADGFA
AAVKEVGRHHFRLFLRGIHAEENLRFWEAVVEFRGQKNKSPAQLTAGKSCLNTFLAEGAN
NEVFLPFGVRQVIEKKIQEKDVDISLFDEAIKHVEQVLRNDPYVRFLQSPQYLNLLAKLK
N
Download sequence
Identical sequences A0A0D6M033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]