SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6M1Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6M1Z8
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 2.88e-17
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6M1Z8
Sequence length 190
Comment (tr|A0A0D6M1Z8|A0A0D6M1Z8_9BILA) Signal recognition particle domain protein {ECO:0000313|EMBL:EPB78134.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_02774 OC=Ancylostoma.
Sequence
MTVLTNEEFLSQLGKMYMDARLGGAKSVYALLYVYRSGQRSDDGRTKALPKDADPQPVDG
HKCLFRAKLGRKRISTVVTSKEVNKFHLAYVSVLRANMDNLERRKKTDTAKTKVTPKKNK
AYKRRWECVFCESECTQCGCLALAENATLIASHKPTIMLLICADRVVLEDAVKFHNIYYN
EFEWSPEQKV
Download sequence
Identical sequences A0A0D6M1Z8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]