SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6M9B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6M9B6
Domain Number 1 Region: 28-166
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 9.15e-31
Family Nicotinic receptor ligand binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6M9B6
Sequence length 174
Comment (tr|A0A0D6M9B6|A0A0D6M9B6_9BILA) Neurotransmitter-gated ion-channel ligand binding domain protein {ECO:0000313|EMBL:EPB76432.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_04490 OC=Ancylostoma.
Sequence
MLTAVLAFVLNLAWAKELGYEKLLDEQRIIRNLLENPQSDYDWRVRPRGRLNEPDYVDAD
PVIITVNMYLRSISKVDDVNMEYSLHFTFREEWVDERLYFNSPTLKHIVLSPGQRIWVPD
TFFQNEKDGKKHDIDTPNILIRVHNGTARILYSCRLTLTLSCPMKYEQSVLLPY
Download sequence
Identical sequences A0A0D6M9B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]