SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6NB78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6NB78
Domain Number 1 Region: 1-127,163-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-41
Family Nucleotide and nucleoside kinases 0.0000177
Further Details:      
 
Domain Number 2 Region: 126-163
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000000017
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6NB78
Sequence length 216
Comment (tr|A0A0D6NB78|A0A0D6NB78_9PROT) Adenylate monophosphate kinase {ECO:0000256|HAMAP-Rule:MF_00235} KW=Complete proteome; Reference proteome OX=1231340 OS=Acetobacter indonesiensis 5H-1. GN=Abin_015_206 OC=Acetobacteraceae; Acetobacter.
Sequence
MNIIFLGPPGAGKGTQSKRLEERYGLVQISTGDMLRAEVARGSDVGNQAKSLMDSGRLVP
DELIIAMLKSRIEQPDCAKGFILDGFPRTTGQAEALDTMLTADKKKIDVVLFLDVDEDIL
ADRISGRFTCAKCGATYNEVSNPPKQEGVCDACGSHEFKRRADDKRETVVERLKEYRKLT
APILPFYEKTGRLHKINGMLSTAEVTAQIEAVMAGQ
Download sequence
Identical sequences A0A0D6NB78 A0A252AWQ3
WP_048845419.1.71388 WP_048845419.1.78331 WP_048845419.1.86399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]