SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6QCM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6QCM5
Domain Number 1 Region: 57-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000144
Family SMI1/KNR4-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6QCM5
Sequence length 192
Comment (tr|A0A0D6QCM5|A0A0D6QCM5_9DELT) Uncharacterized protein {ECO:0000313|EMBL:GAO01228.1} KW=Complete proteome OX=1300915 OS=Anaeromyxobacter sp. PSR-1. GN=PSR1_00080 OC=Cystobacterineae; Anaeromyxobacteraceae; Anaeromyxobacter.
Sequence
MSKTQRKVDLAIDEFVARVNGSPRAALDPEVVPVNLREGRQQAAALDWVAWGIVRAPSPC
AWVDEFEAKLPGRLPRSYGSFVTRYLFPAFDVGPVTLFANTGGGVGERWELVQAAFWDEH
LSTPLLAAGFVQFGRPSGGSYDPVCFDLNKTTNAGECPVVQLDHEAALMGGKVQVVADIA
PSFMALLAREPR
Download sequence
Identical sequences A0A0D6QCM5
WP_059435673.1.99656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]