SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6R090 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6R090
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily Prefoldin 9.15e-25
Family Prefoldin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6R090
Sequence length 153
Comment (tr|A0A0D6R090|A0A0D6R090_ARACU) Uncharacterized protein {ECO:0000313|EMBL:JAG96106.1} OX=56994 OS=Araucaria cunninghamii (Hoop pine) (Moreton Bay pine). GN= OC=Spermatophyta; Pinidae; Araucariales; Araucariaceae; Araucaria.
Sequence
MASDQGKAVVEELNKLTVEQVKQVKEQVDGEVGLLQDSLNRIRTAAVRYEMASKALHNLS
KHPAGKQMLVPLTASLYVPGTLDNADNVLIDVGTGYYVEKTMQEGKEYCERKINFLKANH
DKLVEVATEKKNAADQVNLVLQAKLRQVMSAKQ
Download sequence
Identical sequences A0A0D6R090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]