SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6R3Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6R3Y5
Domain Number 1 Region: 90-248
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.27e-47
Family CRAL/TRIO domain 0.00062
Further Details:      
 
Domain Number 2 Region: 20-81
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000157
Family CRAL/TRIO N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6R3Y5
Sequence length 262
Comment (tr|A0A0D6R3Y5|A0A0D6R3Y5_ARACU) Uncharacterized protein {ECO:0000313|EMBL:JAG98542.1} OX=56994 OS=Araucaria cunninghamii (Hoop pine) (Moreton Bay pine). GN= OC=Spermatophyta; Pinidae; Araucariales; Araucariaceae; Araucaria.
Sequence
MDQSASTQQNGTLGDTNLAQSMTDEDRNKIISMREIIQKADSNSEVVDDPTLRRFLYARE
SDVQNACNLYLKYRKWRQTFVPFGYVSERMISNELKKNLVSMQGFDKKGRPIAVIHLARH
KPCHKTIEDLKRLFVYVFDKMSSSASRGQGKFCIIADLDGWTYKNVDIHGCLAVLEILQD
YYPERLGKVFVIHMPYIFWAAWNIVYPFIDRRTREKVLLIDNKHIQKTLLKDIDESQLPE
IYGGKLPLVPVQDAVIPNWSSN
Download sequence
Identical sequences A0A0D6R3Y5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]