SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6S5I5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6S5I5
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.49e-58
Family AadK C-terminal domain-like 0.0000477
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.07e-48
Family AadK N-terminal domain-like 0.0000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6S5I5
Sequence length 292
Comment (tr|A0A0D6S5I5|A0A0D6S5I5_BACMY) Aminoglycoside 6-adenylyltransferase {ECO:0000313|EMBL:KIV63802.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=SZ39_5265 OC=Bacillus cereus group.
Sequence
MRTEKEMLDLIINTAKEDERIRAVIMNGSRVNPNVKKDCFQDYDIIYVVKDIQSFTCNHS
WINRFGEIMIVQMPEEMSLLPADKDGKFPYLMQFMDGNRIDLMLVPVDLINKFIGQDSLS
KLLXDKDKCIGEFPPASDKDYVIKNPTEKEFLDCCNEFWWCSTNVGKGLWREELSYAKGM
LEGPMRDMLIVMLEWHIGMKTNFTVNTGKFGKHFEQYVEKDTWEQFRKTFSNAEYENIWE
SFFVMGDLFREVANEIANTYGYQYPQDDDDKVTSYLKHVKVLPKDSTSIYPA
Download sequence
Identical sequences A0A0D6S5I5
WP_044444259.1.10033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]