SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6S8R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6S8R0
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.3e-33
Family Ribosomal proteins L24p and L21e 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6S8R0
Sequence length 104
Comment (tr|A0A0D6S8R0|A0A0D6S8R0_9PSED) 50S ribosomal protein L24 {ECO:0000256|HAMAP-Rule:MF_01326} KW=Complete proteome; Reference proteome OX=1604022 OS=Pseudomonas sp. FeS53a. GN=SZ55_4198 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVVGGINLVKRHTKPNPMSGVQGGIVEK
EAPLHVSNVAIFNSETNKADRVGFKIEDGKKIRVFKSTQKPVGA
Download sequence
Identical sequences A0A0D6S8R0
WP_044411011.1.2182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]