SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6SLV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6SLV3
Domain Number 1 Region: 9-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.06e-21
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6SLV3
Sequence length 142
Comment (tr|A0A0D6SLV3|A0A0D6SLV3_BACMY) Uncharacterized protein {ECO:0000313|EMBL:KIV69640.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=SZ39_4312 OC=Bacillus cereus group.
Sequence
MSRVTWLFTDGAIDEQVIIAVENSFGVRFPDDYRECIKKNNGGYPEPDIYDINDDEGGAV
FDCLLSFTSKDANIEVVYELTSLPEGIIPFARDPFGGLICFNYCDTKDSPSVVFYDQESV
NEDKIKLICDSFSELIERLYSD
Download sequence
Identical sequences A0A0D6SLV3 A0A2A8YVZ6 A0A2C5FJU6
WP_044443223.1.10033 WP_044443223.1.59075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]