SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6SU75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6SU75
Domain Number 1 Region: 24-66
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000968
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6SU75
Sequence length 201
Comment (tr|A0A0D6SU75|A0A0D6SU75_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KIV72104.1} KW=Complete proteome; Reference proteome OX=1604022 OS=Pseudomonas sp. FeS53a. GN=SZ55_1949 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDTLQNGIDAYNQTFQELHGEDDELACDGPAPASDIERFQALAGIPLPAELVAFYRHFGS
LKNNTQDDNHCFWLPAPGELVDWLEDQGSGAGLVSLMRAFWGGDRPELDAGTHFDAAQLQ
ALDQRFIGFGWFMGDDMLEGAHFLFFDRAGGFGRLHYHQDRFAEARRGLLGLLESGLPGH
SLEALLGQALDEVREGLEAFG
Download sequence
Identical sequences A0A0D6SU75
WP_044404874.1.2182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]