SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6SX67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6SX67
Domain Number 1 Region: 20-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000103
Family SMI1/KNR4-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6SX67
Sequence length 152
Comment (tr|A0A0D6SX67|A0A0D6SX67_BACMY) Uncharacterized protein {ECO:0000313|EMBL:KIV73250.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=SZ39_2137 OC=Bacillus cereus group.
Sequence
MFNFLKEYVVADRSVRSKQKPIFYPIYQDEIDEAESLLQMELPKELKRFYQEIGCGFLKY
DKRTFFNRFMDPISVADFRLRQDIYEYNPNLDDVDDDESLVFFEVTELNFLTIKFKEENE
LDQCPIYSEDEKIADSLEEFLIKMDENPDYYI
Download sequence
Identical sequences A0A0D6SX67 A0A2A8MTV6
WP_044440338.1.10033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]