SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6T9T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6T9T9
Domain Number 1 Region: 10-193
Classification Level Classification E-value
Superfamily VC0467-like 1.31e-58
Family VC0467-like 0.00000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6T9T9
Sequence length 194
Comment (tr|A0A0D6T9T9|A0A0D6T9T9_9RHOB) UPF0301 protein SY26_15285 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1192054 OS=Paracoccus sp. 228. GN=SY26_15285 OC=Rhodobacteraceae; Paracoccus.
Sequence
MTGDSAQDRNLTGKILIAMPGMSDPRFERSVVLVCAHSDEGAMGLVLNRPLPEIGFGDLL
DQLGIEAEEDARPIEVRFGGPVEPGRGFVLHKVAEHGQDPEGRLRIGQALAMTTTRDILV
ELAQGYGPDPAVLALGYAGWGPGQLETEMLANGWLTGDGAEDLIFDLSHEDKWQRALRAQ
GIDPSLLSAASGRA
Download sequence
Identical sequences A0A0D6T9T9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]