SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6TGT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6TGT8
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 1.78e-33
Family Ribosomal L27 protein 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6TGT8
Sequence length 90
Comment (tr|A0A0D6TGT8|A0A0D6TGT8_9RHOB) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=1192054 OS=Paracoccus sp. 228. GN=SY26_04495 OC=Rhodobacteraceae; Paracoccus.
Sequence
MAHKKAGGSSRNGRDSAGRRLGVKLFGGQAAIAGNIIARQRGTTWWPGVNVGMGKDHTLF
ALTDGHVSFKKGLKGRTFISIVPAELEAAE
Download sequence
Identical sequences A0A0D6TGT8
WP_045999405.1.91967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]