SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6UNK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6UNK2
Domain Number 1 Region: 28-82,117-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000615
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6UNK2
Sequence length 203
Comment (tr|A0A0D6UNK2|A0A0D6UNK2_STRGR) Uncharacterized protein {ECO:0000313|EMBL:KIX33923.1} KW=Complete proteome OX=1911 OS=Streptomyces griseus. GN=BF14_5321 OC=Streptomyces.
Sequence
MSWMMTGMNTETCAPSEAAALREIFASHPDAAPPAGWEAVRSFEAEHGIVLPEPYRSCVA
EISDGLRAGPPDYGLLPLAQTPSDWGEGRAERLLAQPFPLTEAWQWEGGDEEDEGGEELS
DEEFETRVEAVYDHGSLLLGTDGCGMYWHLITTGPQRGHVWLIDEFGAIPFGTRPGALVM
PGTPGIAGWVAHWAEGRSWFADD
Download sequence
Identical sequences A0A0D6UNK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]