SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6WN89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6WN89
Domain Number 1 Region: 16-85
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0000209
Family Thermostable phytase (3-phytase) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6WN89
Sequence length 90
Comment (tr|A0A0D6WN89|A0A0D6WN89_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KIX76946.1} KW=Complete proteome; Reference proteome OX=1592330 OS=Streptomyces sp. MBRL 601. GN=SF12_16245 OC=Streptomyces.
Sequence
MGGGEQTGRAYIGSFTAAGGAGVITAAVAPDGGLTVLGATAEVPDPSYLALGPGGDLLYA
VSETADGAVAAFDPAGDTARLLAPPAPVAA
Download sequence
Identical sequences A0A0D6WN89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]