SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6WSY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6WSY4
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000301
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6WSY4
Sequence length 171
Comment (tr|A0A0D6WSY4|A0A0D6WSY4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KIX78175.1} KW=Complete proteome; Reference proteome OX=1592330 OS=Streptomyces sp. MBRL 601. GN=SF12_10215 OC=Streptomyces.
Sequence
YARLAPPAEPGATAAAEAALHLRFPAELRASLGCHDGAGGEGVLPVKPPLSVAGIVRYWT
RWMEFTEEEREFGDPEEEGEPSWHPRWIPWAESDGDAQIIDGRDGPGFGRLGMKYHDEEG
SFGDDAPSLAAYLTEVADVLERGGSVGGRVPYLAVSGVLWWAEEPAARPAR
Download sequence
Identical sequences A0A0D6WSY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]