SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7A476 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7A476
Domain Number 1 Region: 58-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-22
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 148-210
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.42e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 4-57
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000795
Family ECR1 N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D7A476
Sequence length 230
Comment (tr|A0A0D7A476|A0A0D7A476_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KIY45189.1} KW=Complete proteome; Reference proteome OX=1128425 OS=Fistulina hepatica ATCC 64428. GN=FISHEDRAFT_49792 OC=Fistulina.
Sequence
MFCVLPGEIVPAQHVNLKLGPGLRQIPLQDENITVSTKAGMVQHSANNAKWWIDSNSRRY
VPAAQESVVGVVVQKAGEGFRVDIGSAHMASLDGLAFEGATKRNRPNLKIGSLVYARVSL
AHKDMEPELECFDAQTRKAEGFGELKQGFLVKCSLRMARLLMSPDHFLLPFLGSLFPLEA
AVGMNGRVWISASSPKQIIAMKRCIEGADPDGGGVSESDLKQFVHSLDLI
Download sequence
Identical sequences A0A0D7A476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]