SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7A8M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7A8M2
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.1e-43
Family Cofilin-like 0.00000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D7A8M2
Sequence length 138
Comment (tr|A0A0D7A8M2|A0A0D7A8M2_9AGAR) Cofilin {ECO:0000313|EMBL:KIY46739.1} KW=Complete proteome; Reference proteome OX=1128425 OS=Fistulina hepatica ATCC 64428. GN=FISHEDRAFT_66338 OC=Fistulina.
Sequence
MSSGVGVNHDCLAKFQELKLGKKTKYIIFNLNDDNTEIVVEKTSTSTDYDEFLADLPEAD
CRWAVYDFEYEKEDAGKRNKICFIAWSPDDAKIKKKMVFASSKDALRRSLVGVATDIQGT
DMSEVSYESVLAKASKSA
Download sequence
Identical sequences A0A0D7A8M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]