SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7ATI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7ATI5
Domain Number 1 Region: 43-88,135-205
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000397
Family Regulator of G-protein signaling, RGS 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7ATI5
Sequence length 395
Comment (tr|A0A0D7ATI5|A0A0D7ATI5_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KIY61305.1} KW=Complete proteome; Reference proteome OX=1314674 OS=Cylindrobasidium torrendii FP15055 ss-10. GN=CYLTODRAFT_231368 OC=Cylindrobasidium.
Sequence
MSPSDNNGERTSGRRATGWRERRAYLPTLFPLAEKLNAKRLASVTLEQILAGGTCFPIGL
PDFELYLAYNMASIEQLQFVVWYRDYRKRIQERVLRIRTETNGSFVSTSTETKRSLTGSE
LEPMVFDIMQTSGVALHDAELRDECLRVVATFLLPNSPKCLNTAARTRETIIQGLESTCH
YELFESLYESTYAALEEQVLPRFLAHALSNMNMPKQLLWYALGMLVLATAVLGAALMIHF
IPPPESNRAYRLITLLPLSSGIIMLGAALTGFCAQSHRRGARQIHTWELQQVNEEAARYV
ASFRSKAHDMPQALVCNSTDGSYSGKALPVTQRRNTTTKADIRLTRPAFFGPEQVIEDKT
VLKAHRRLMNDLITLAVCCDLVFAIIILSIPGHST
Download sequence
Identical sequences A0A0D7ATI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]