SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7B496 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7B496
Domain Number 1 Region: 57-132,159-204
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000523
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7B496
Sequence length 559
Comment (tr|A0A0D7B496|A0A0D7B496_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KIY65393.1} KW=Complete proteome; Reference proteome OX=1314674 OS=Cylindrobasidium torrendii FP15055 ss-10. GN=CYLTODRAFT_66240 OC=Cylindrobasidium.
Sequence
MLTVLCSAGGPSRRSSLLPLHHDQLHTAFAPASSYTPPAVSWNRIKAWLAREYPELGDTL
NYGILPQDLAAVEQQFGFALPPVVRESYLAVDGQEPESAAGCSEGLFFGLSILPLDDVYE
EWRFWREVDDDPATGANTRLRASMQSLPPNWIKREYSSRGWIPLIADKAGNYVGVDLSPG
ESGVQGQVIVFGRDFDTKVVLWNGDGPVGWSKWLAAFADDLEAGEGFEIGQPEGSDDGED
DIGYESYYYDGSGTTGDGGGNSNAATGLRLTGEYKGWSVLEAWADKSVRKWFDSGVISQE
EAEEPPMSPTKSKAPENSLDILDVTQPAAAEIPIPVLGDYDGSESSISPAPRRSDSTLTT
PTARKPSANLPTISVTKPPAPLPVELPTPRDLTSLPSPPDSTHSSFEDIESGRSSRHQAE
PSARQSGHPLRQDSEASEGVPEAPLLPATPPESTTRISPPIDIPDLMSDATPLDEPLVET
EPDNGTGIRLVGGGGVVGVMSEEPEEEESTPEPESTSTAETPEVTEKKHKKTKSSIASLG
KVLGGKKKKDSTSEAADSN
Download sequence
Identical sequences A0A0D7B496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]