SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7B5S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7B5S1
Domain Number 1 Region: 36-81,132-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000339
Family Regulator of G-protein signaling, RGS 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7B5S1
Sequence length 394
Comment (tr|A0A0D7B5S1|A0A0D7B5S1_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KIY65903.1} KW=Complete proteome; Reference proteome OX=1314674 OS=Cylindrobasidium torrendii FP15055 ss-10. GN=CYLTODRAFT_491945 OC=Cylindrobasidium.
Sequence
MSHDHDGRGTRTVAQRDYLVKLFPLAEKLNAKRLASVSLEQVLAGKTCYPISLPDFELYL
AYNEMCIGKLQFVVWYRDYRHRLDTRIARMSQISFASDSTLVTAPTAIDITSPKTFAPSL
EILPVTRKPDSDFHNPALYEECMQVVTTFLSPNSSKTLRIDSALREQITQKLEASCHYDL
FEPIYKETYAALESEILPRFLAHALSNINLPKQLLWYALAVICFVDSIVTAVFAIYFIPP
PRVNRAWRLIAVVPFYLSAVFAMAAFCGFCSQVFHRDSRQIHAWELRQMDEESNLYAGSM
RATGPTPIAVVCNSTDGTYTGKCVPITSRSKHNAHGSTDTTRSVRPAIYGPERVIEDATV
LKAHRGLMNDLLGFALLCSLVFSTVVFLIPGRST
Download sequence
Identical sequences A0A0D7B5S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]