SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7BQ93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7BQ93
Domain Number 1 Region: 391-435,462-511,541-574
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.28e-30
Family Regulator of G-protein signaling, RGS 0.00071
Further Details:      
 
Domain Number 2 Region: 239-334
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000134
Family DEP domain 0.035
Further Details:      
 
Domain Number 3 Region: 33-142
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000167
Family MukF N-terminal domain-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7BQ93
Sequence length 639
Comment (tr|A0A0D7BQ93|A0A0D7BQ93_9AGAR) Regulator of G protein signaling superfamily {ECO:0000313|EMBL:KIY71761.1} KW=Complete proteome; Reference proteome OX=1314674 OS=Cylindrobasidium torrendii FP15055 ss-10. GN=CYLTODRAFT_486880 OC=Cylindrobasidium.
Sequence
MPSEDPLSPASSHMMKTTKRGRPFLKDTLDLFATLIVSLELSTHKQFFRTFPNSFSTDDA
AANLASLKFSQSNRGPDPREPSRVVTTTTTTTFSMTRDMAKAMSQHFMDARLIENAADPS
SNLFKDRGVYVLTPKGLHVLERFISKNGISSDHLQQVFVSQPICVKLLHLERRSADDEII
VTQSVITALFRRFVGRAPNYSQSTQPVTDPFAKYNERARGCTLMDVTEKAQPLLGKSQQT
HKYCFAAVTALEWLCDFTSVVGREEAAEMAAQFVRFGLITLVSDKRKNNDSAIIFTVRGS
TPGGNSPVTQQGEFRCTPKAIYRITDEGRRVAHWDHRLDSPSASSANLSTERSSVDKGEH
PDKKSGDAKIHRRISMAEKLNAAYDHGEKKNQKESNAERLRYILEEPGLRSLFREFLRTN
FCEENLSFWLDVDDFKRKFGVTSSAVASSVRGAGVKGTPGQQAMERHHEALINTAFLIYH
TYLAPSSQCELNIDHGLRNELSKYLEDAVTNLTGKSTFTGRVEPEQAAAFNATQLQTMIR
LYERIQTHVFRLMATDSVPRFIKTPKFLAMRNWVDDFDPNDDDVRLLPSAPSQPPGLGGE
EVGGAYITISQQGSERQQNLHRQEQQSGQGSGSPAPASP
Download sequence
Identical sequences A0A0D7BQ93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]