SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7KKB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7KKB4
Domain Number 1 Region: 29-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000804
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7KKB4
Sequence length 168
Comment (tr|A0A0D7KKB4|A0A0D7KKB4_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KJB86581.1} KW=Complete proteome OX=1458845 OS=Paenibacillus sp. E194. GN=AZ66_18030 OC=Paenibacillus.
Sequence
MMKIIEIIQKIEQDSNCRLVKRTTDFTNELALPEDLNYFFSHYDSLQMFLDKPYGIKIVS
SNEFLPTSKRLYPEDDVIWDELEGDISNEWYLIAESEQINQYISIDLSDSHLGYCYDSFL
ETHATPGDSQIIAKSFTELLEHLYASKGENWFWLADNFESYGDAYDGR
Download sequence
Identical sequences A0A0D7KKB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]