SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7KLQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7KLQ4
Domain Number 1 Region: 158-312
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-30
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 27-120
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000244
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7KLQ4
Sequence length 460
Comment (tr|A0A0D7KLQ4|A0A0D7KLQ4_9BACL) Glucan biosynthesis protein {ECO:0000313|EMBL:KJB86844.1} KW=Complete proteome OX=1458845 OS=Paenibacillus sp. E194. GN=AZ66_16535 OC=Paenibacillus.
Sequence
MNQVLMDQLNQWHEDDEHQRIVDTLLAIPENERDYKMKSRLVAAYNNLGLFEEALQQADR
IAEEGQHDPLWHYRVGFTFYHVKRYEEAVQAFRTADQLQPGDEDIEYLMELSLQKAEKQQ
RQERRIAAKKEAALKANGSAAIEPFSDMSLDDFWDDSEYAREAYQSEPPTDELIVSIEEE
LGYKLPSSYIALMKQRNGGVPKNTCFPTEDATSWSEDHIAITGILGIGREKSYSLCGDLG
SQFMIEDWGYPDIGVVICDCPSAGHDVVMLDYRACGRDGEPEVIHVDQEGDYEITFLADN
FEAFIRGLVNEEEYDTSEEDKLEDLHRVAHGKFSPLLEELCSNVVEVDQIEPKIRRICTC
IVEEKGHFSFHADERSYLMYDVQFWLYTKSYPETSREQYLGIYEKMIAFGGEFGQGGYAP
SFISDWLDRRKKEGRIVQVNGHLRFTEQSIEELVRQLQEV
Download sequence
Identical sequences A0A0D7KLQ4
WP_044355698.1.37970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]