SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7WVD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7WVD0
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.02e-20
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7WVD0
Sequence length 152
Comment (tr|A0A0D7WVD0|A0A0D7WVD0_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KJD42934.1} KW=Complete proteome OX=159743 OS=Paenibacillus terrae. GN=QD47_25480 OC=Paenibacillus.
Sequence
MNIEFESSFKPIKSQEVETFEETYNITFPNDYKNFLLYHNGGKTIRRRFETQDKTITTSI
MLFLPLSKETENNLENYYKKYTIEKIIPSNFLPIGVDPADSLICLSINGKDQGIVYFCDM
DYFEEDNELKQEFIKFVSPSFSEFVNSLFLPD
Download sequence
Identical sequences A0A0D7WVD0
WP_044648736.1.30217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]