SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7WXG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7WXG0
Domain Number 1 Region: 19-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-19
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7WXG0
Sequence length 173
Comment (tr|A0A0D7WXG0|A0A0D7WXG0_9BACL) Molybdenum cofactor biosysnthesis protein MoeA {ECO:0000313|EMBL:KJD42422.1} KW=Complete proteome OX=159743 OS=Paenibacillus terrae. GN=QD47_28345 OC=Paenibacillus.
Sequence
MMHQAESLWQRIIEKGISKEADFEKKLNLQVGARDEDFQILESTLGIKLPEEMKNFYRVH
NGQDWKVGISSFVRNLTLSPIAQIIDNWKFIQEEFDPDDLELDADNEISPCLWNPKWVPI
AENGSGDYLCLDTDPSEVGVVGQVLYFWHDWGNRSVEGNNLYEFIEICLEEED
Download sequence
Identical sequences A0A0D7WXG0
WP_044649272.1.30217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]