SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7X1H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7X1H1
Domain Number 1 Region: 32-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000235
Family SMI1/KNR4-like 0.014
Further Details:      
 
Domain Number 2 Region: 214-432
Classification Level Classification E-value
Superfamily ARM repeat 0.00000188
Family RPA1889-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D7X1H1
Sequence length 444
Comment (tr|A0A0D7X1H1|A0A0D7X1H1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KJD43872.1} KW=Complete proteome OX=159743 OS=Paenibacillus terrae. GN=QD47_20315 OC=Paenibacillus.
Sequence
MWFGKKETQLDRIKNKLNQAMRKDTAFSVFGASSHQYKVNGKLTAKELADWQAHNQVTLP
EPYAQFLTKVGNGGAGPYYGIYPIEKAASYTERQALLAKSVLHPGMAKEEWNHLIEPLTK
DEDIPDEEYDDTCNKVLGGMLCIGTQGCEYDMYLVLEGKYRGRIVYTSDFHPDHPFFFVY
EDSFLDWYERWLDEIILDYDIGWFGSRIPGDENALIQIYQSAPNEEIQAKALDGMSKFKK
ISQPTLGFLKNIAEQSPKNRTAAIWLICKTSFDAGRKYLLELLQSDGHEDFLQALQILHA
SSKTADLTECISVILQRLDRIHDPETLRYAGYILEDYGGITLQNFAPFLCHADPKMQTTA
IYAARSCENKLGGWQIIEQMLMGGGPQVMNNLILYWGIIPHEKLLPYYKAVWPKYQRDPK
FREKFIGCLRELHLPDDYFDKDES
Download sequence
Identical sequences A0A0D7X1H1
WP_044647836.1.30217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]