SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7XI01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7XI01
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily BAS1536-like 0.000000000000116
Family BAS1536-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7XI01
Sequence length 60
Comment (tr|A0A0D7XI01|A0A0D7XI01_BACAM) Uncharacterized protein {ECO:0000313|EMBL:KJD55142.1} KW=Complete proteome OX=1390 OS=Bacillus amyloliquefaciens (Bacillus velezensis). GN=UZ38_23810 OC=Bacillus amyloliquefaciens group.
Sequence
MNNKIEAKRLALFEAAEKFGINSKEAIQCSQELDNLLNQRMQKDENCVIHAEERKGRHTS
Download sequence
Identical sequences A0A0D7XI01 R9TVG5
gi|511062081|ref|YP_008077399.1| WP_020450876.1.100763 WP_020450876.1.17986 WP_020450876.1.21808 WP_020450876.1.25580 WP_020450876.1.26113 WP_020450876.1.36620 WP_020450876.1.36854 WP_020450876.1.36860 WP_020450876.1.42174 WP_020450876.1.47125 WP_020450876.1.64701 WP_020450876.1.74801 WP_020450876.1.75289 WP_020450876.1.80397 WP_020450876.1.82128 WP_020450876.1.82679 WP_020450876.1.83084 WP_020450876.1.8660 WP_020450876.1.97335 WP_020450876.1.98137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]