SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7XJK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D7XJK8
Domain Number - Region: 11-62
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0235
Family N-utilization substance G protein NusG, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7XJK8
Sequence length 83
Comment (tr|A0A0D7XJK8|A0A0D7XJK8_BACAM) Membrane protein {ECO:0000313|EMBL:KJD55766.1} KW=Complete proteome OX=1390 OS=Bacillus amyloliquefaciens (Bacillus velezensis). GN=UZ38_20625 OC=Bacillus amyloliquefaciens group.
Sequence
MKVFILFYLWIVPLVIGLIFFRVTQRTSFKKRFYPGYIMIGLAAAVFAVCYLIGQPYLGN
FFGGTMLFGTLLPFMAAAMKKKK
Download sequence
Identical sequences A0A0D7XJK8 A0A1Q8GP44 R9TTC9
WP_020450232.1.100763 WP_020450232.1.17986 WP_020450232.1.21808 WP_020450232.1.25580 WP_020450232.1.26113 WP_020450232.1.36620 WP_020450232.1.36854 WP_020450232.1.36860 WP_020450232.1.42174 WP_020450232.1.47125 WP_020450232.1.74801 WP_020450232.1.75289 WP_020450232.1.80397 WP_020450232.1.82679 WP_020450232.1.83084 WP_020450232.1.97335 WP_020450232.1.98137 gi|511061376|ref|YP_008076694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]