SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7XPS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7XPS4
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-25
Family SMI1/KNR4-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7XPS4
Sequence length 121
Comment (tr|A0A0D7XPS4|A0A0D7XPS4_BACAM) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KJD57547.1} KW=Complete proteome OX=1390 OS=Bacillus amyloliquefaciens (Bacillus velezensis). GN=UZ38_11660 OC=Bacillus amyloliquefaciens group.
Sequence
MTEEEFRAAEKSLGATFPKAYKRLIHKKNPAEIGEWTFFPIREQSRLQKTWDDVIRQNSV
CREESMPDDLIVIADNGTGDKLCLKKTDSVMEETVYLWDHETADVELYAASIGEFIENEK
E
Download sequence
Identical sequences A0A0D7XPS4
WP_044802386.1.18446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]