SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8BV88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8BV88
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 4.88e-32
Family Ribosomal L27 protein 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8BV88
Sequence length 96
Comment (tr|A0A0D8BV88|A0A0D8BV88_GEOKU) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome OX=1462 OS=Geobacillus kaustophilus. GN=LG52_383 OC=Geobacillus thermoleovorans group.
Sequence
MLRLDLQFFASKKGVGSTKNGRDSIAKRLGAKRADGQFVTSGSILYRQRGTKVHPGLNVG
RGGDDTLYAKIDGIVRFERLGRDRKRVSVYPVSQEA
Download sequence
Identical sequences A0A063YQJ9 A0A063YQQ1 A0A098L138 A0A0D8BV88 A0A0E0TF30 A0A0J0V6B3 A0A0K2H740 A0A0N1KHH4 A0A142D2R2 A0A1C3D427 A0A1Q5TA61 A0A1V4PDG5 A0A1V9C8V9 A0A2H5KKM7 G8N3K2 L7ZUK3 Q5KWP3 T0NW54 U2X230
gi|448238886|ref|YP_007402944.1| gi|261418377|ref|YP_003252059.1| WP_011232084.1.100150 WP_011232084.1.13089 WP_011232084.1.17728 WP_011232084.1.19233 WP_011232084.1.20723 WP_011232084.1.2219 WP_011232084.1.22479 WP_011232084.1.25743 WP_011232084.1.3446 WP_011232084.1.38260 WP_011232084.1.38928 WP_011232084.1.45808 WP_011232084.1.46340 WP_011232084.1.50933 WP_011232084.1.57889 WP_011232084.1.59104 WP_011232084.1.60903 WP_011232084.1.6497 WP_011232084.1.65208 WP_011232084.1.70239 WP_011232084.1.72400 WP_011232084.1.76536 WP_011232084.1.77642 WP_011232084.1.78869 WP_011232084.1.80994 WP_011232084.1.8599 WP_011232084.1.86012 WP_011232084.1.90668 WP_011232084.1.91533 WP_011232084.1.9165 WP_011232084.1.92435 WP_011232084.1.93593 gi|297529229|ref|YP_003670504.1| gi|375009703|ref|YP_004983336.1| gi|56421143|ref|YP_148461.1| gi|319767664|ref|YP_004133165.1| 235909.GK2608 544556.GYMC61_0910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]