SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8DHC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8DHC4
Domain Number 1 Region: 5-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-17
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8DHC4
Sequence length 163
Comment (tr|A0A0D8DHC4|A0A0D8DHC4_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KJE47920.1} KW=Complete proteome OX=137584 OS=Thalassomonas viridans. GN=SG34_03175 OC=Colwelliaceae; Thalassomonas.
Sequence
MNSLLEKIRKSKDCIVHPPSGLPLINDGHTLPKDLVDFYRECGGIKFFINSNYAIEIVAP
EKLILSNPEILPKGWEADIPEDDISNDWYIVAEAGPEQKISIDLNKNRIGKCYDSFWDIH
ASPGDCPILAISFSELLKRIFNCKGGYWFWLADEFINLGDAYD
Download sequence
Identical sequences A0A0D8DHC4
WP_044837076.1.63240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]