SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8I2F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8I2F5
Domain Number 1 Region: 61-179
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000314
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8I2F5
Sequence length 207
Comment (tr|A0A0D8I2F5|A0A0D8I2F5_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:KJF24403.1} KW=Complete proteome; Reference proteome OX=103808 OS=Rhodococcus sp. AD45. GN=SZ00_01324 OC=Rhodococcus.
Sequence
MIPLLQKVTDDETTGEASNRDGIVSVEDVLTHGLTVDGQPTLEHIDFAVLDSFRFPDGDG
FPASYRAFIRHAGWARSFGLWLIYPPVHPGFADGWQGRAGYLTANLHSAYREGHSEEFDW
MVEPDGDWSLPASLHVFGLSENGDALLWDTTSRGTDGEFPVWESRSLNSLHRLGDSLSEA
LPSIRDRALSLFGPRTYDIEPLPPIPL
Download sequence
Identical sequences A0A0D8I2F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]