SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8IXC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8IXC1
Domain Number 1 Region: 960-1130
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.62e-31
Family SMI1/KNR4-like 0.0061
Further Details:      
 
Domain Number 2 Region: 300-385,805-842,871-924
Classification Level Classification E-value
Superfamily TPR-like 0.00000000178
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D8IXC1
Sequence length 1829
Comment (tr|A0A0D8IXC1|A0A0D8IXC1_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KJF39350.1} KW=Complete proteome OX=1550024 OS=Ruthenibacterium lactatiformans. GN=TQ39_12910 OC=Ruthenibacterium.
Sequence
MGGSDDSLNLVAFLEDQKKEEIPLSEIFAKIGLDKQNWDFRQTVEYLEFTHSDGVEMDFH
FAIDVVTDLAAILLECSVSGSVNLQDLDEYNTPARHIRITVTPEEHDAMNKALADFAHNP
LEYDLSEMMDNEEIQEMARDVESLRKELYEAAGRNRDYHVKAEDVKSLLPDWEGADGCIA
TNRITVEGYKVGYCYRENPDGGWDSGWRFTAGDESEAYMDDPNNAGIYKLNTICNDDPDI
IPLLNTPAPCAFERDENGVFQQIKDWKPDEDEEDPDMDILKQCQKWHEEDKHQKIVDALE
AISAEERTPEMDMELARAYNNLADPSEPEGKKLLHRALELMQSHEEELGDTYSWNFRMGY
AYYYLDQEGRALRYFEKALELHPGDDPKLNTRQDMEELIDSCKKSISLPQFSECFREQTE
DWWETFAEMEAELRQMMDEDKDHTRGAELVAQMQETLNLVFDEISFEMGFNGEKYELILT
PEGDKVKLFELVYFQKHAPKEVLEHWNILVGRQPLQNIGLRTEDGWDISGDDVQIWLEEQ
GENSFAISAYCEKLLPMLREEEGRAWWMLTTLTDQVLGEIPHMRYIDSFDVLEEPKAEPS
FLLSQLPDKLREQGLELSTDPEAYLESYLGYKMEPKQDPDADWRLDVMAGSTCCVPLING
YLNADNDFMDDLHADGAVAGFFCYPLNTLREEEGSQKIFDFRDKLEEVFATDEGSEVLTL
TGGATGLYCGYVDFIAWDIRTALQMAKEFFEGSDIPWAIFHTFRREAGSVPLKQQDDGPE
TENQDDELNETLTGMDYIPYTQQNAEAFFAQLEQWNDEDEYTRCIQALNAIPEDWRNYRT
AYALARALENYAIIGDHDEGTLKSKGDKALLRAIEVLESVREEGQDKAEWNMRMAYGYQY
LYGQEEKAIPYAERWAELDPEDENAPAVIRECKAEIRKRQRSRKKKAKFVPGDTPFEGFD
LTNFWDDNWYALKEYVSDPPSDELIASVEEELGYKLPAAYIWLMKQHNGGIPVNTCYPCD
EPTCWSDDHVAITGIFGIGREKSCSLCGELGSQFMIAEWEYPAIGVAICDCPSAGHDMIF
LDYRACGPQGEPAVVHVDQENDYKITHLADSFEEFIRGLEHESLYDPDEDAEDLEDDADE
EETDHKGSFAGSVLLSKAEWDKEQLIRDLREEWGIVDEEPDEGDEDVENSDDAVVMRVGN
MMLIVTLFHGHIPDNEAEINAENNYMWPEAVEVAKAHKAHIMVAVLGEEEKLLERGKLFT
KAMAVCCKQKYATGVYTSGVVFEPRFYEGLADMLKKDELPIFNWVWFGLYRSEGGLNGYT
YGMDVFGKEEMEVLNTDAEPEELRDFLASLASYVLACDVTLQDGETIGFSADDKHTITRS
PGVSLPEEQMTLKIGYEPIKGDPEDDDDSIGMDDVSYHIENLEEKELPIDPINAYNHMAI
YLRWCMEHDLMGGKFLAEHGEVVNQVKADPGNTDLRTFIREELFGCLFSALFNQKGRAFA
HYYYGEIDAPYYPADIDDYALKYFGPSRYHSNEFQQEAYLFIPFDEDYYQAMAEVIEERF
TNWQGQDFDEDTLEPSEVAQAIMEYLDCECTYFPSMADDDPIMSAYSYARRLGVREGFVP
VLIQADDETQLECLVMNADPEHDADFYEFDLKTVEEYRKKMLSAPIKDGKAILEELTGQR
KEEAEDDDLDWDEEVLGEMEGGEPNDRFANYWNDDTGMTYPLILAKIPVKNPWEIFAYLP
FGNWNECPDTPDLMAVAKYWFEQHGAIPAAMSHDELEFELPTPISKERAMEVAVEQYGFC
PDLDQNEDGSIGSLAAVLWQSTVWYFWWD
Download sequence
Identical sequences A0A0D8IXC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]