SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XCR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XCR6
Domain Number 1 Region: 12-143
Classification Level Classification E-value
Superfamily PHM/PNGase F 4.39e-28
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XCR6
Sequence length 222
Comment (tr|A0A0D8XCR6|A0A0D8XCR6_DICVI) Copper type II ascorbate-dependent monooxygenase domain protein {ECO:0000313|EMBL:KJH42398.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_11610 OC=Dictyocaulus.
Sequence
MKPFSHQLHRSAHLPEQGIYIFGSQLHAHLTGRKIFSSHYRYGVKIGEINRDDHYSPHWQ
HIVHLNPYIHVVPGDVISTTCIYETLSRDSVTLLIDVREGGYGIEDEMCVNYIYYFPVSE
VEVCKSAVDNASLHRHFHNKYDIRQTSLPIYQKYASVNWNEKNTLLLKELFAVAPLNINC
LKHDGLPFPNHPLNWTGVPQPRVRMTPFTKQRDRNECPALND
Download sequence
Identical sequences A0A0D8XCR6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]