SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XML0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XML0
Domain Number 1 Region: 63-221
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.26e-28
Family Regulator of G-protein signaling, RGS 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XML0
Sequence length 241
Comment (tr|A0A0D8XML0|A0A0D8XML0_DICVI) Regulator of G protein signaling-like domain protein {ECO:0000313|EMBL:KJH44987.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_08971 OC=Dictyocaulus.
Sequence
MGLRDSENREKLDRALKRIVSLQSQLHHVKPVEPPWSQPPMNGDSDDDDTGSSPGKYTEI
DSHGPFSNLAELKTHPAHLAMFIDYLLSNASPNSLFFYLITDAFQIAQGAPKDFRRWAFE
IFTTFVIPNSPLVIPNSDQSIIQPIDKVSIILSTTVDQICESDVDILKRVFVPGRQRAVA
DINDHMANFRQKRQFGLDTIFDANQLTHLVRGDSAMETRVCGIVALSLIIHITSSSAAGK
K
Download sequence
Identical sequences A0A0D8XML0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]