SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XPP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XPP1
Domain Number 1 Region: 18-70
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.71e-19
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XPP1
Sequence length 123
Comment (tr|A0A0D8XPP1|A0A0D8XPP1_DICVI) Thyroglobulin type-1 repeat-containing domain protein {ECO:0000313|EMBL:KJH45749.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_08189 OC=Dictyocaulus.
Sequence
MTAVEADKFYLQADCDAFCLKDGVFLPRCDLEGYYRPEQCHKGYCWCVDRFGREFDNSRI
KNELPDCGQYGRNSDSWQFQVNEKIGKTVLLCKMKGASDIDNGYKLFTPVILTGVGITLE
EEQ
Download sequence
Identical sequences A0A0D8XPP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]