SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XSP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XSP7
Domain Number 1 Region: 248-373
Classification Level Classification E-value
Superfamily PapD-like 1.78e-26
Family MSP-like 0.0012
Further Details:      
 
Domain Number 2 Region: 3-163
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.14e-16
Family CRAL/TRIO domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XSP7
Sequence length 472
Comment (tr|A0A0D8XSP7|A0A0D8XSP7_DICVI) Major sperm protein {ECO:0000256|RuleBase:RU003425} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_07143 OC=Dictyocaulus.
Sequence
MLLWINFAQYRPGDTGFENVFVFWLERHTMETKGTPLTILLDMSGTSMKNMDFNIFKFIF
HVLKYYYPDIVHDMIVFESPPILNASWKVDILRFLYSFIKISMKEFLIQKICVKIMKSWL
DPAHPQIHFLTKDTITRHVDKKNLPPHMGGEDNFKFTMDDLVKCLPASQQNGNHSNISDG
EYCMDRDGFDSFMKKGVTFDDDDDEANRKAPLTLCRKTSNLSIKRGIPECLKPVVEARLR
SPEVNWIKNAFLEISPRDVLNLNRVDNVTDFVDVVVVRNTSQIPVMFKIKTTSPEKFRVR
PTMGIILPESTEIIRVYLQNEYKNSCTREKFLLMALESENNNLETFGELWKNTHSERKVE
QKLRCRLNNANLSDGYTNDNIDGGTNSVSQQGQIDRLRAQCEVMQRTQFILIIIMLMLFF
ILIVIVVNERWRFNALETTLNIFSNKLNTTECDKTSADKQLSSRAIKYEDEL
Download sequence
Identical sequences A0A0D8XSP7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]