SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XU62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XU62
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.02e-35
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XU62
Sequence length 226
Comment (tr|A0A0D8XU62|A0A0D8XU62_DICVI) PAP/25A associated domain protein {ECO:0000313|EMBL:KJH48168.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_05737 OC=Dictyocaulus.
Sequence
DWRVRPLVSVVKEWAKRKGINDANRSSFTSYSLVLMVIHYLQCGTEPGVLPSLQQMFPRR
FANKCDVRTLNVTLPLDTPAVSEWHYADKSTLGELLIGFLDYYANKFESYSTHSFFSYDR
DAISVRLGKRIDRAVIARQRPNGGYQQSGTHWRSQWRCICIEEPFTYSNTAHSIYDEMVF
DAIKTAFREAHQELDSTRDLQRLLNCKPISVNAPMGGYVAVALCKL
Download sequence
Identical sequences A0A0D8XU62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]