SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XUJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XUJ4
Domain Number 1 Region: 505-579
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000134
Family DIX domain 0.0091
Further Details:      
 
Domain Number 2 Region: 6-144
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000471
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XUJ4
Sequence length 582
Comment (tr|A0A0D8XUJ4|A0A0D8XUJ4_DICVI) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KJH48273.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_05635 OC=Dictyocaulus.
Sequence
MPSEWDRPHMRWTLRLEYVLSDRNALDAFRDWLVANSSPQPLELHFALLAYDRMSAQRNA
QTADLARSIYQKYISLRTASCCFNFIPHKIRQEVGVCLKSTGSGLPDPRLFSAVLPYVDS
FLRQQHEQFVCSEEFLEAFNRMNMSCEDSGDFSTERRRSTATPKKPQLTAEILMKTRHDR
EHVLGESSLEKMYPASGMPRPYVCHATTSQNDSAVSSSFSSDANGHRTTRLRSIREEHLR
GNPTTFAIPVCNTVNYTNAMIKGKNAKSDIFRASIFRVEHHSKGDMLKFDHNSEDGRKIF
AGVLCKKLGRLQARRERNDETERQLRDIEDRKCTTRELISTSEAVHVVAGDDDDDVECYL
ERMKEDSHKTSANRSPYHNTLSPRPFSPEHDRRKMDCVISDGSMGMESMSTSSYLRATNE
FAPPPLTYNFNTSGVYYKEMRSRNQTAPIYDSSGVESMAPSAFSDTSGGSRKTPLNVQSL
STPRRGRRSIPSSGQQLMTISYKGFDGVPVVAHVPISLKGITLKEFRRYFSISSHANIQF
FFKSICEDGSAPYQLLLVNEDSAYLPIFEGRITAELKRVSPE
Download sequence
Identical sequences A0A0D8XUJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]