SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8XXA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XXA4
Domain Number 1 Region: 65-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.27e-31
Family G proteins 0.0000716
Further Details:      
 
Domain Number 2 Region: 10-73
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 9.81e-18
Family Transducin (alpha subunit), insertion domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XXA4
Sequence length 238
Comment (tr|A0A0D8XXA4|A0A0D8XXA4_DICVI) G-protein alpha subunit {ECO:0000313|EMBL:KJH48452.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_05422 OC=Dictyocaulus.
Sequence
MAEEEIQLSCFTSEISTAIQKVWKDPAVQKLYERRSEINLNDSSKYFLENLSNINRLDFV
PTPRDLIMSYVPTVGVQNVVFSAGNRVFQLFDIGGLRIDRRKWATMYDGIDAIFFCIAIS
EYDQVMVEDPETNRLQDSLSLLEKISNEPKFKNTPLFLFLNEIDVFREKLPLIPLENYLS
EYKGRSVQEALDFIESLARQSLAGRDQAVIHIYRTCMIDTEQMSKILESAFQTILSAA
Download sequence
Identical sequences A0A0D8XXA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]