SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8Y4Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8Y4Y0
Domain Number 1 Region: 36-212
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.43e-19
Family Poly(A) polymerase, PAP, N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 202-260
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 8.44e-17
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8Y4Y0
Sequence length 294
Comment (tr|A0A0D8Y4Y0|A0A0D8Y4Y0_DICVI) Nucleotidyltransferase domain protein {ECO:0000313|EMBL:KJH49631.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_04241 OC=Dictyocaulus.
Sequence
MSEEESDTAKLLKQYEYYIVEPNIQAIKQYRKQYSGLFENPTYASKLCELSREIHQYFYT
YIENDEDYQTKMNSMEKVRKIIMKYRSWRFELFPSGSTVTGLATKGSDLDLILWCPDAQT
IFYDEETAVFNILRLVRHFLLIDVEIRDELDNVCYVEAKVPILKIKFQGGLSIDLSCCVA
MFISGVLNSYLIRGFTLWDAKVAPLCVLIKEWARCHGIKNSTNGGFNSYALVLLIIHFLQ
CVANPPILPNLPKLFPKMYGLEVDSKFLLSEILSSNKKPIPYDRGGKLCFSYLR
Download sequence
Identical sequences A0A0D8Y4Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]