SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8Y7Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8Y7Y9
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 4.05e-39
Family Nip7p homolog, N-terminal domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 1.82e-24
Family PUA domain 0.0000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8Y7Y9
Sequence length 180
Comment (tr|A0A0D8Y7Y9|A0A0D8Y7Y9_DICVI) 60S ribosome subunit biogenesis protein NIP7 homolog {ECO:0000256|PIRNR:PIRNR017190} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_00842 OC=Dictyocaulus.
Sequence
MRPLTNEETEKVFAKLATFIGDNVALLIDRVDGDYCFRNHKDRVYYCSENLMRQAATIAR
EPLLSFGTCLGKFTKSQKFHLHITALDYLAPYAKYRVWLKPNAEQQFLYGNNVLKSGVSR
MTEDVPTYAGIIVYNMHDVPLGFGVVAKSTADCKRADPTAIVVLHQCDLGEYIRKESSLI
Download sequence
Identical sequences A0A0D8Y7Y9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]