SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9NB70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9NB70
Domain Number 1 Region: 13-142
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000107
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9NB70
Sequence length 146
Comment (tr|A0A0D9NB70|A0A0D9NB70_PREIN) 1,3-beta-glucan synthase regulator {ECO:0000313|EMBL:KJJ86254.1} KW=Complete proteome OX=1347790 OS=Prevotella intermedia ZT. GN=M573_134010 OC=Prevotella.
Sequence
MILNVLSTKAATFNKIEGDFSFCFPEDYRSFLSEYNGVNIEDYYVRVKDLNEDVMPNNLF
STDDELNRALTLRFWNREYEEDIPEHSLLIGDFQDGAFLLLIPEGEYKGLYYYDHAYSFE
QSDDGCNTYFLAETFSDFLKSMKQDV
Download sequence
Identical sequences A0A0D9NB70 A0A2D3LUY7
WP_045168225.1.67154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]