SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9NQY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9NQY0
Domain Number 1 Region: 43-89,179-249
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-20
Family Regulator of G-protein signaling, RGS 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9NQY0
Sequence length 403
Comment (tr|A0A0D9NQY0|A0A0D9NQY0_METAN) Uncharacterized protein {ECO:0000313|EMBL:KJK76306.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_08366 OC=Metarhizium.
Sequence
MYWPTWLTWYKKPEYRNIKEYSDAIRSGKRDYSPDRSGCVIPPKLRLDRVLGNKTCSPMS
LFDFYMYLKHIEFSEENLEFYMWYKNYQRCYNGPSAQGKRDCLGISDNASPNTSTLHMST
PTETKHVDVSAGAVERVLSQIRQLLGASATCTSGTKCKLTCVDDAESCEAGDDKLPKHSK
SDDAYRDQVLAIARTFLLPGSPKELNIPCHMRSQVLADIETSSHPSHLEPVADHVYQLLQ
HCSHRNFVRLGIANGTFETVCVATGLGIVLIVAGLLTVLLLAFTPSRGSHSPWTVFASWP
MLWLGMSLVLSGLRGSCFFLLLFSRRQPLPWERFADEESGRLRRTARLGFLSRLMIFDNK
VRVKDLHLRRLQHKIVIQSLVGGATFASLGVLLFIFLPVWRTS
Download sequence
Identical sequences A0A0D9NQY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]