SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9P6B5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9P6B5
Domain Number 1 Region: 27-212
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.18e-27
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00057
Further Details:      
 
Domain Number 2 Region: 389-527
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000157
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9P6B5
Sequence length 593
Comment (tr|A0A0D9P6B5|A0A0D9P6B5_METAN) Uncharacterized protein {ECO:0000313|EMBL:KJK81817.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_03080 OC=Metarhizium.
Sequence
MENLSFLPPRLTSSASSCSSLNDMSSRNRKLRLLVAATGPRDTSWAQALVVRLSKNPHIE
MRAIVDDVVPRLTQTIIVLENRSLAAGQCGRADDVDFFRQQAFDLVEWADLLVCVPLDAD
GIAKMLAGIADTFLGEVFRGWNIQKSIVLVPGMSTHMWSNPTTKRQLSKIHRKWNWIRVM
TPILWHYEGQMNPKRVPNWNGFNEVLGIIKNQADLLGLGRDVEIATSAAVVPDTNDVQIR
SKLPPEIWTMVLDHAGDWELAKALGMYTNLPMPTTWSLEPKDPADPLKVYEHQLEWTVLT
GNPAAICKKLSQSPPNFQYVPALVVKLVIRFALIDVLAYMEANRPELFRAFDGTTLPTNA
SAYYPRTDVLDFWKQSKWFRDEHMYDAEAVDGASKNGHVRILDWWWRRSGLPLRYTETAL
EQASGRGHLLVLEWWRDAAAQDEEIVLRPGRSLLWASQYGQADVLQWWDASGIPVAHGDG
VAKVASRWGQVQVLETWRRLKGDNKLVFDAEVLLSSTIHQHVDVLEWWRRFAHGELQGME
GRKQPVEFRTCNIEEALEDSIGDPDQNPARKWWARYGLDLRMRNEEWLQTRYL
Download sequence
Identical sequences A0A0D9P6B5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]