SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9REK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9REK9
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.01e-45
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000114
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000301
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Weak hits

Sequence:  A0A0D9REK9
Domain Number - Region: 354-457
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00863
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9REK9
Sequence length 475
Comment (tr|A0A0D9REK9|A0A0D9REK9_CHLSB) Ankyrin repeat, SAM and basic leucine zipper domain containing 1 {ECO:0000313|Ensembl:ENSCSAP00000007048} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ASZ1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAAGALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKGLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSTFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQTILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGIGLEHMTDLLKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEEIKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSQKITLEWASPRNFTSVCEELVNNVEDLSEEVCKLK
DLIQKLQNERENDPTHIQLREEVSTWNSRILKRTAITVCGFGFLLFICKLTFQRK
Download sequence
Identical sequences A0A0D9REK9 A0A2K5Z0U3 Q2IBB1
XP_007980883.1.81039 XP_011836972.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]